Anti-MYO5A
Artikelnummer:
ATA-HPA001356
- Bilder (6)
| Artikelname: | Anti-MYO5A |
| Artikelnummer: | ATA-HPA001356 |
| Hersteller Artikelnummer: | HPA001356 |
| Alternativnummer: | ATA-HPA001356-100,ATA-HPA001356-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GS1, MYH12, MYO5, MYR12 |
| myosin VA (heavy chain 12, myoxin) |
| Anti-MYO5A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4644 |
| UniProt: | Q9Y4I1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MYO5A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to microtubule organizing center & focal adhesion sites. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
HPA001356-100ul |
|
|
|
|
|
HPA001356-100ul |
|
|
HPA001356-100ul |
Produktgarantie und fachkundiger Support
