Anti-MYO5A
Catalog Number:
ATA-HPA001356
- Images (6)
| Article Name: | Anti-MYO5A |
| Biozol Catalog Number: | ATA-HPA001356 |
| Supplier Catalog Number: | HPA001356 |
| Alternative Catalog Number: | ATA-HPA001356-100,ATA-HPA001356-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GS1, MYH12, MYO5, MYR12 |
| myosin VA (heavy chain 12, myoxin) |
| Anti-MYO5A |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4644 |
| UniProt: | Q9Y4I1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MYO5A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to microtubule organizing center & focal adhesion sites. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
HPA001356-100ul |
|
|
|
|
|
HPA001356-100ul |
|
|
HPA001356-100ul |
Product Guarantee and Expert Support
