Anti-PRICKLE1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001379
Artikelname: Anti-PRICKLE1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001379
Hersteller Artikelnummer: HPA001379
Alternativnummer: ATA-HPA001379-100,ATA-HPA001379-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EPM1B, FLJ31937
prickle homolog 1 (Drosophila)
Anti-PRICKLE1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 144165
UniProt: Q96MT3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNMGTLNSSMLHRSAESLKSLSSELCPEKILPEEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYDIEI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-PRICKLE1 antibody. Corresponding PRICKLE1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.