Anti-PRICKLE1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PRICKLE1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001379
• Supplier Catalog Number: HPA001379
• Alternative Catalog Number: ATA-HPA001379-100,ATA-HPA001379-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: EPM1B, FLJ31937

Product Description

prickle homolog 1 (Drosophila)

Additional Information

Anti-PRICKLE1

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 144165
• UniProt: Q96MT3
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNMGTLNSSMLHRSAESLKSLSSELCPEKILPEEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYDIEI
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-PRICKLE1 antibody. Corresponding PRICKLE1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex shows high expression.

Immunohistochemical staining of human skeletal muscle shows low expression as expected.