Anti-FHL1
Artikelnummer:
ATA-HPA001391
- Bilder (6)
| Artikelname: | Anti-FHL1 |
| Artikelnummer: | ATA-HPA001391 |
| Hersteller Artikelnummer: | HPA001391 |
| Alternativnummer: | ATA-HPA001391-100,ATA-HPA001391-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bA535K18.1, FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA |
| four and a half LIM domains 1 |
| Anti-FHL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2273 |
| UniProt: | Q13642 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKIRRAPPLSNN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FHL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-FHL1 antibody. Corresponding FHL1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows high expression. |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
HPA001391-100ul |
|
|
HPA001391-100ul |
|
|
HPA001391-100ul |
Produktgarantie und fachkundiger Support
