Anti-FHL1
Catalog Number:
ATA-HPA001391
- Images (6)
| Article Name: | Anti-FHL1 |
| Biozol Catalog Number: | ATA-HPA001391 |
| Supplier Catalog Number: | HPA001391 |
| Alternative Catalog Number: | ATA-HPA001391-100,ATA-HPA001391-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | bA535K18.1, FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA |
| four and a half LIM domains 1 |
| Anti-FHL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 2273 |
| UniProt: | Q13642 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKIRRAPPLSNN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FHL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-FHL1 antibody. Corresponding FHL1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows high expression. |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
HPA001391-100ul |
|
|
HPA001391-100ul |
|
|
HPA001391-100ul |
Product Guarantee and Expert Support
