Anti-FLOT1

Artikelnummer: ATA-HPA001393
Artikelname: Anti-FLOT1
Artikelnummer: ATA-HPA001393
Hersteller Artikelnummer: HPA001393
Alternativnummer: ATA-HPA001393-100,ATA-HPA001393-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLOT1
flotillin 1
Anti-FLOT1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 10211
UniProt: O75955
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FLOT1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human adrenal gland and skin tissues using Anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human adrenal gland shows high expression.
Immunohistochemical staining of human skin shows low expression as expected.
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA001393-100ul
HPA001393-100ul
HPA001393-100ul