Anti-FLOT1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001393
Article Name: Anti-FLOT1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001393
Supplier Catalog Number: HPA001393
Alternative Catalog Number: ATA-HPA001393-100,ATA-HPA001393-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLOT1
flotillin 1
Anti-FLOT1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 10211
UniProt: O75955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FLOT1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human adrenal gland and skin tissues using Anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human adrenal gland shows high expression.
Immunohistochemical staining of human skin shows low expression as expected.
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA001393
HPA001393
HPA001393