Anti-TXNRD1
Artikelnummer:
ATA-HPA001395
- Bilder (6)
| Artikelname: | Anti-TXNRD1 |
| Artikelnummer: | ATA-HPA001395 |
| Hersteller Artikelnummer: | HPA001395 |
| Alternativnummer: | ATA-HPA001395-100,ATA-HPA001395-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GRIM-12, Trxr1, TXNR |
| thioredoxin reductase 1 |
| Anti-TXNRD1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7296 |
| UniProt: | Q16881 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TXNRD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells and basal cells in the seminiferous ducts. |
|
|
Western blot analysis in human cell lines PC-3 and MCF-7 using Anti-TXNRD1 antibody. Corresponding TXNRD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue |
|
|
HPA001395-100ul |
|
|
HPA001395-100ul |
|
|
HPA001395-100ul |
Produktgarantie und fachkundiger Support
