Anti-TXNRD1

Catalog Number: ATA-HPA001395
Article Name: Anti-TXNRD1
Biozol Catalog Number: ATA-HPA001395
Supplier Catalog Number: HPA001395
Alternative Catalog Number: ATA-HPA001395-100,ATA-HPA001395-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GRIM-12, Trxr1, TXNR
thioredoxin reductase 1
Anti-TXNRD1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 7296
UniProt: Q16881
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TXNRD1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells and basal cells in the seminiferous ducts.
Western blot analysis in human cell lines PC-3 and MCF-7 using Anti-TXNRD1 antibody. Corresponding TXNRD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human cell line A-431
Lane 5: Human liver tissue
HPA001395-100ul
HPA001395-100ul
HPA001395-100ul