Anti-IMPDH2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001400
Artikelname: Anti-IMPDH2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001400
Hersteller Artikelnummer: HPA001400
Alternativnummer: ATA-HPA001400-100,ATA-HPA001400-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IMPDH2
IMP (inosine 5-monophosphate) dehydrogenase 2
Anti-IMPDH2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 3615
UniProt: P12268
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IMPDH2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & rods & rings.
Immunohistochemical staining of human breast shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IMPDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in human cell line U-251 MG.
HPA001400
HPA001400
HPA001400