Anti-IMPDH2 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001400
Article Name: Anti-IMPDH2 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001400
Supplier Catalog Number: HPA001400
Alternative Catalog Number: ATA-HPA001400-100,ATA-HPA001400-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IMPDH2
IMP (inosine 5-monophosphate) dehydrogenase 2
Anti-IMPDH2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 3615
UniProt: P12268
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IMPDH2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & rods & rings.
Immunohistochemical staining of human breast shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IMPDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in human cell line U-251 MG.
HPA001400
HPA001400
HPA001400