Anti-AMBP

Artikelnummer: ATA-HPA001497
Artikelname: Anti-AMBP
Artikelnummer: ATA-HPA001497
Hersteller Artikelnummer: HPA001497
Alternativnummer: ATA-HPA001497-100,ATA-HPA001497-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
alpha-1-microglobulin/bikunin precursor
Anti-AMBP
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 259
UniProt: P02760
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECRE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: AMBP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human testis shows weak positivity in plasma.
Immunohistochemical staining of human colon shows no cytoplasmic positivity in glandular cells as expected.
Immunohistochemical staining of human placenta shows moderate positivity in plasma.
Immunohistochemical staining of human liver shows weak cytoplasmic positivity in hepatocytes.
Western blot analysis in control (vector only transfected HEK293T lysate) and AMBP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400613).
HPA001497-100ul
HPA001497-100ul
HPA001497-100ul