Anti-AMBP
Catalog Number:
ATA-HPA001497
- Images (8)
| Article Name: | Anti-AMBP |
| Biozol Catalog Number: | ATA-HPA001497 |
| Supplier Catalog Number: | HPA001497 |
| Alternative Catalog Number: | ATA-HPA001497-100,ATA-HPA001497-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI |
| alpha-1-microglobulin/bikunin precursor |
| Anti-AMBP |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 259 |
| UniProt: | P02760 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECRE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | AMBP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human testis shows weak positivity in plasma. |
|
|
Immunohistochemical staining of human colon shows no cytoplasmic positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human placenta shows moderate positivity in plasma. |
|
|
Immunohistochemical staining of human liver shows weak cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and AMBP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400613). |
|
|
HPA001497-100ul |
|
|
HPA001497-100ul |
|
|
HPA001497-100ul |
Product Guarantee and Expert Support
