Anti-ZBTB16 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA001499
| Artikelname: |
Anti-ZBTB16 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA001499 |
| Hersteller Artikelnummer: |
HPA001499 |
| Alternativnummer: |
ATA-HPA001499-100,ATA-HPA001499-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
PLZF, ZNF145 |
| zinc finger and BTB domain containing 16 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.2 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
7704 |
| UniProt: |
Q05516 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
ZBTB16 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human adrenal gland shows moderate to strong nuclear positivity in glandular cells. |
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neuronal cells. |
|
Immunohistochemical staining of human testis shows moderate to strong positivity in nuclear membrane in cells in seminiferous ducts. |
|
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected. |
|
Western blot analysis in human cell line HEL. |
|
HPA001499 |
|
|
|
HPA001499 |
|
HPA001499 |