Anti-ZBTB16 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001499
Article Name: Anti-ZBTB16 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001499
Supplier Catalog Number: HPA001499
Alternative Catalog Number: ATA-HPA001499-100,ATA-HPA001499-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PLZF, ZNF145
zinc finger and BTB domain containing 16
Anti-ZBTB16
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 7704
UniProt: Q05516
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ZBTB16
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human adrenal gland shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neuronal cells.
Immunohistochemical staining of human testis shows moderate to strong positivity in nuclear membrane in cells in seminiferous ducts.
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
Western blot analysis in human cell line HEL.
HPA001499
HPA001499
HPA001499