Anti-ATP5B
Artikelnummer:
ATA-HPA001528
- Bilder (14)
| Artikelname: | Anti-ATP5B |
| Artikelnummer: | ATA-HPA001528 |
| Hersteller Artikelnummer: | HPA001528 |
| Alternativnummer: | ATA-HPA001528-100,ATA-HPA001528-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ATPSB |
| ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide |
| Anti-ATP5B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 506 |
| UniProt: | P06576 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVAR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ATP5B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. |
|
|
Immunohistochemical staining of human kidney, liver, prostate and small intestine using Anti-ATP5B antibody HPA001528 (A) shows similar protein distribution across tissues to independent antibody HPA001520 (B). |
|
|
Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATP5B antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis using Anti-ATP5B antibody HPA001528 (A) shows similar pattern to independent antibody HPA001520 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA001528-100ul |
|
|
|
|
|
|
|
|
HPA001528-100ul |
|
|
HPA001528-100ul |
Produktgarantie und fachkundiger Support
