Anti-ATF3

Artikelnummer: ATA-HPA001562
Artikelname: Anti-ATF3
Artikelnummer: ATA-HPA001562
Hersteller Artikelnummer: HPA001562
Alternativnummer: ATA-HPA001562-100,ATA-HPA001562-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ATF3
activating transcription factor 3
Anti-ATF3
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 467
UniProt: P18847
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ATF3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemical staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.
Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.
Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected.
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
HPA001562-100ul
HPA001562-100ul
HPA001562-100ul