Anti-ATF3 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001562
Article Name: Anti-ATF3 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001562
Supplier Catalog Number: HPA001562
Alternative Catalog Number: ATA-HPA001562-100,ATA-HPA001562-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ATF3
activating transcription factor 3
Anti-ATF3
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 467
UniProt: P18847
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ATF3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemical staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.
Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.
Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected.
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
HPA001562
HPA001562
HPA001562