Anti-RRP7A
Artikelnummer:
ATA-HPA001586
| Artikelname: |
Anti-RRP7A |
| Artikelnummer: |
ATA-HPA001586 |
| Hersteller Artikelnummer: |
HPA001586 |
| Alternativnummer: |
ATA-HPA001586-100,ATA-HPA001586-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ICC, IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
CGI-96 |
| ribosomal RNA processing 7 homolog A (S. cerevisiae) |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
27341 |
| UniProt: |
Q9Y3A4 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
VRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYA |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
RRP7A |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus. |
|
Immunohistochemical staining of human caudate shows nucleolar positivity in neuronal cells and nuclear positivity in glial cells. |
|
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line EFO-21 Lane 4: Human cell line A-431 |
|
HPA001586-100ul |
|
|
|
|
|
HPA001586-100ul |
|
HPA001586-100ul |