Anti-RRP7A
Catalog Number:
ATA-HPA001586
- Images (8)
| Article Name: | Anti-RRP7A |
| Biozol Catalog Number: | ATA-HPA001586 |
| Supplier Catalog Number: | HPA001586 |
| Alternative Catalog Number: | ATA-HPA001586-100,ATA-HPA001586-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CGI-96 |
| ribosomal RNA processing 7 homolog A (S. cerevisiae) |
| Anti-RRP7A |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 27341 |
| UniProt: | Q9Y3A4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RRP7A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus. |
|
|
Immunohistochemical staining of human caudate shows nucleolar positivity in neuronal cells and nuclear positivity in glial cells. |
|
|
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line EFO-21 Lane 4: Human cell line A-431 |
|
|
HPA001586-100ul |
|
|
|
|
|
|
|
|
HPA001586-100ul |
|
|
HPA001586-100ul |
Product Guarantee and Expert Support
