Anti-RBP4 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001641
Artikelname: Anti-RBP4 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001641
Hersteller Artikelnummer: HPA001641
Alternativnummer: ATA-HPA001641-100,ATA-HPA001641-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
retinol binding protein 4, plasma
Anti-RBP4
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5950
UniProt: P02753
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RBP4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
HPA001641
HPA001641
HPA001641