Anti-RBP4 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RBP4 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001641
• Supplier Catalog Number: HPA001641
• Alternative Catalog Number: ATA-HPA001641-100,ATA-HPA001641-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: Pan-Cancer

Product Description

retinol binding protein 4, plasma

Additional Information

Anti-RBP4

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 5950
• UniProt: P02753
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: RBP4
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50

Images

Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.

HPA001641

HPA001641

HPA001641