Anti-RBP4 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001641
Article Name: Anti-RBP4 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001641
Supplier Catalog Number: HPA001641
Alternative Catalog Number: ATA-HPA001641-100,ATA-HPA001641-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Pan-Cancer
retinol binding protein 4, plasma
Anti-RBP4
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 5950
UniProt: P02753
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RBP4
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
HPA001641
HPA001641
HPA001641