Anti-TJP2

Artikelnummer: ATA-HPA001813
Artikelname: Anti-TJP2
Artikelnummer: ATA-HPA001813
Hersteller Artikelnummer: HPA001813
Alternativnummer: ATA-HPA001813-100,ATA-HPA001813-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DFNA51, X104, ZO-2, ZO2
tight junction protein 2
Anti-TJP2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 9414
UniProt: Q9UDY2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TJP2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm & cell junctions.
Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Western blot analysis in human cell lines A-431 and SK-MEL-30 using Anti-TJP2 antibody. Corresponding TJP2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
HPA001813-100ul
HPA001813-100ul
HPA001813-100ul