Anti-TJP2
Catalog Number:
ATA-HPA001813
- Images (8)
| Article Name: | Anti-TJP2 |
| Biozol Catalog Number: | ATA-HPA001813 |
| Supplier Catalog Number: | HPA001813 |
| Alternative Catalog Number: | ATA-HPA001813-100,ATA-HPA001813-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DFNA51, X104, ZO-2, ZO2 |
| tight junction protein 2 |
| Anti-TJP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 9414 |
| UniProt: | Q9UDY2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TJP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm & cell junctions. |
|
|
Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells. |
|
|
Western blot analysis in human cell lines A-431 and SK-MEL-30 using Anti-TJP2 antibody. Corresponding TJP2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
|
|
|
|
|
|
HPA001813-100ul |
|
|
HPA001813-100ul |
|
|
HPA001813-100ul |
Product Guarantee and Expert Support
