Anti-TMOD3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001849
Artikelname: Anti-TMOD3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001849
Hersteller Artikelnummer: HPA001849
Alternativnummer: ATA-HPA001849-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: UTMOD
tropomodulin 3 (ubiquitous)
Anti-TMOD3
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 29766
UniProt: Q9NYL9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TMOD3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
Immunohistochemical staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines A-549 and HEK293 using Anti-TMOD3 antibody. Corresponding TMOD3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
HPA001849
HPA001849
HPA001849