Anti-TMOD3

Catalog Number: ATA-HPA001849
Article Name: Anti-TMOD3
Biozol Catalog Number: ATA-HPA001849
Supplier Catalog Number: HPA001849
Alternative Catalog Number: ATA-HPA001849-100,ATA-HPA001849-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: UTMOD
tropomodulin 3 (ubiquitous)
Anti-TMOD3
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 29766
UniProt: Q9NYL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TMOD3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
Immunohistochemical staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines A-549 and HEK293 using Anti-TMOD3 antibody. Corresponding TMOD3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
HPA001849-100ul
HPA001849-100ul
HPA001849-100ul