Anti-PSMC4
Artikelnummer:
ATA-HPA002044
- Bilder (7)
| Artikelname: | Anti-PSMC4 |
| Artikelnummer: | ATA-HPA002044 |
| Hersteller Artikelnummer: | HPA002044 |
| Alternativnummer: | ATA-HPA002044-100,ATA-HPA002044-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC13687, MGC23214, MGC8570, MIP224, S6, TBP-7, TBP7 |
| proteasome (prosome, macropain) 26S subunit, ATPase, 4 |
| Anti-PSMC4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5704 |
| UniProt: | P43686 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PSMC4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human gall bladder shows nuclear positivity in glandular cells. |
|
|
Western blot analysis in human cell line A-549. |
|
|
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12. |
|
|
HPA002044-100ul |
|
|
HPA002044-100ul |
|
|
HPA002044-100ul |
Produktgarantie und fachkundiger Support
