Anti-PSMC4
Catalog Number:
ATA-HPA002044
- Images (7)
| Article Name: | Anti-PSMC4 |
| Biozol Catalog Number: | ATA-HPA002044 |
| Supplier Catalog Number: | HPA002044 |
| Alternative Catalog Number: | ATA-HPA002044-100,ATA-HPA002044-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MGC13687, MGC23214, MGC8570, MIP224, S6, TBP-7, TBP7 |
| proteasome (prosome, macropain) 26S subunit, ATPase, 4 |
| Anti-PSMC4 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5704 |
| UniProt: | P43686 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PSMC4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human gall bladder shows nuclear positivity in glandular cells. |
|
|
Western blot analysis in human cell line A-549. |
|
|
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12. |
|
|
HPA002044-100ul |
|
|
HPA002044-100ul |
|
|
HPA002044-100ul |
Product Guarantee and Expert Support
