Anti-HYAL1
Artikelnummer:
ATA-HPA002112
- Bilder (8)
| Artikelname: | Anti-HYAL1 |
| Artikelnummer: | ATA-HPA002112 |
| Hersteller Artikelnummer: | HPA002112 |
| Alternativnummer: | ATA-HPA002112-100,ATA-HPA002112-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FUS2, HYAL-1, LUCA1, NAT6 |
| hyaluronoglucosaminidase 1 |
| Anti-HYAL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3373 |
| UniProt: | Q12794 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HYAL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human liver and tonsil tissues using HPA002112 antibody. Corresponding HYAL1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human gallbladder shows moderate to strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows very weak positivity as expected. |
|
|
HPA002112-100ul |
|
|
HPA002112-100ul |
|
|
HPA002112-100ul |
Produktgarantie und fachkundiger Support
