Anti-HYAL1
Catalog Number:
ATA-HPA002112
- Images (8)
| Article Name: | Anti-HYAL1 |
| Biozol Catalog Number: | ATA-HPA002112 |
| Supplier Catalog Number: | HPA002112 |
| Alternative Catalog Number: | ATA-HPA002112-100,ATA-HPA002112-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FUS2, HYAL-1, LUCA1, NAT6 |
| hyaluronoglucosaminidase 1 |
| Anti-HYAL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 3373 |
| UniProt: | Q12794 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HYAL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human liver and tonsil tissues using HPA002112 antibody. Corresponding HYAL1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human gallbladder shows moderate to strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows very weak positivity as expected. |
|
|
HPA002112-100ul |
|
|
HPA002112-100ul |
|
|
HPA002112-100ul |
Product Guarantee and Expert Support
