Anti-PLVAP
Artikelnummer:
ATA-HPA002279
- Bilder (7)
| Artikelname: | Anti-PLVAP |
| Artikelnummer: | ATA-HPA002279 |
| Hersteller Artikelnummer: | HPA002279 |
| Alternativnummer: | ATA-HPA002279-100,ATA-HPA002279-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FELS, gp68, PV-1, PV1 |
| plasmalemma vesicle associated protein |
| Anti-PLVAP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 83483 |
| UniProt: | Q9BX97 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PLVAP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human duodenum shows strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human fallopian tube shows strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human tonsil shows strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
HPA002279-100ul |
|
|
HPA002279-100ul |
|
|
HPA002279-100ul |
Produktgarantie und fachkundiger Support
