Anti-PLVAP
Catalog Number:
ATA-HPA002279
- Images (7)
| Article Name: | Anti-PLVAP |
| Biozol Catalog Number: | ATA-HPA002279 |
| Supplier Catalog Number: | HPA002279 |
| Alternative Catalog Number: | ATA-HPA002279-100,ATA-HPA002279-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FELS, gp68, PV-1, PV1 |
| plasmalemma vesicle associated protein |
| Anti-PLVAP |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 83483 |
| UniProt: | Q9BX97 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLVAP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human duodenum shows strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human fallopian tube shows strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human tonsil shows strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
HPA002279-100ul |
|
|
HPA002279-100ul |
|
|
HPA002279-100ul |
Product Guarantee and Expert Support
