Anti-S100A12 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA002881
Artikelname: Anti-S100A12 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA002881
Hersteller Artikelnummer: HPA002881
Alternativnummer: ATA-HPA002881-100,ATA-HPA002881-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CAAF1, CAGC, CGRP, ENRAGE, MRP6, p6
S100 calcium binding protein A12
Anti-S100A12
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 6283
UniProt: P80511
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: S100A12
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-S100A12 antibody. Corresponding S100A12 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Western blot analysis in human spleen tissue.
Western blot analysis in control (vector only transfected HEK293T lysate) and S100A12 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401723).
HPA002881
HPA002881
HPA002881