Anti-S100A12 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA002881
Article Name: Anti-S100A12 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA002881
Supplier Catalog Number: HPA002881
Alternative Catalog Number: ATA-HPA002881-100,ATA-HPA002881-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAAF1, CAGC, CGRP, ENRAGE, MRP6, p6
S100 calcium binding protein A12
Anti-S100A12
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 6283
UniProt: P80511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: S100A12
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-S100A12 antibody. Corresponding S100A12 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Western blot analysis in human spleen tissue.
Western blot analysis in control (vector only transfected HEK293T lysate) and S100A12 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401723).
HPA002881
HPA002881
HPA002881