Anti-DNAAF2

Artikelnummer: ATA-HPA002894
Artikelname: Anti-DNAAF2
Artikelnummer: ATA-HPA002894
Hersteller Artikelnummer: HPA002894
Alternativnummer: ATA-HPA002894-100,ATA-HPA002894-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C14orf104, CILD10, FLJ10563, KTU, PF13
dynein, axonemal, assembly factor 2
Anti-DNAAF2
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 55172
UniProt: Q9NVR5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIAVKALQIDSFGLVTCFQQESLDVSQMILGKSQQPESKMQSEFIKEKSATCSNEEKGNLNESVITEEKETDGDHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAAF2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human parathyroid gland shows strong cytoplasmic and membranous positivity in glandular cells.
HPA002894-100ul