Anti-DNAAF2
Catalog Number:
ATA-HPA002894
| Article Name: |
Anti-DNAAF2 |
| Biozol Catalog Number: |
ATA-HPA002894 |
| Supplier Catalog Number: |
HPA002894 |
| Alternative Catalog Number: |
ATA-HPA002894-100,ATA-HPA002894-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Molekularbiologie |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
C14orf104, CILD10, FLJ10563, KTU, PF13 |
| dynein, axonemal, assembly factor 2 |
| Clonality: |
Polyclonal |
| Concentration: |
0.4 mg/ml |
| Isotype: |
IgG |
| NCBI: |
55172 |
| UniProt: |
Q9NVR5 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
LQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIAVKALQIDSFGLVTCFQQESLDVSQMILGKSQQPESKMQSEFIKEKSATCSNEEKGNLNESVITEEKETDGDHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIK |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
DNAAF2 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:200 - 1:500 |
![]()
|
Immunohistochemical staining of human parathyroid gland shows strong cytoplasmic and membranous positivity in glandular cells. |
![]()
|
HPA002894-100ul |
