Anti-CSPG4

Artikelnummer: ATA-HPA002951
Artikelname: Anti-CSPG4
Artikelnummer: ATA-HPA002951
Hersteller Artikelnummer: HPA002951
Alternativnummer: ATA-HPA002951-100,ATA-HPA002951-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HMW-MAA, MCSP, MCSPG, MEL-CSPG, MSK16, NG2
chondroitin sulfate proteoglycan 4
Anti-CSPG4
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 1464
UniProt: Q6UVK1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CSPG4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemical staining of human placenta shows moderate membranous and cytoplasmic positivity in trophoblast.
Immunohistochemical staining of human prostate shows moderate membranous and cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and CSPG4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419670).
HPA002951-100ul
HPA002951-100ul
HPA002951-100ul