Anti-CSPG4

Catalog Number: ATA-HPA002951
Article Name: Anti-CSPG4
Biozol Catalog Number: ATA-HPA002951
Supplier Catalog Number: HPA002951
Alternative Catalog Number: ATA-HPA002951-100,ATA-HPA002951-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HMW-MAA, MCSP, MCSPG, MEL-CSPG, MSK16, NG2
chondroitin sulfate proteoglycan 4
Anti-CSPG4
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1464
UniProt: Q6UVK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CSPG4
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemical staining of human placenta shows moderate membranous and cytoplasmic positivity in trophoblast.
Immunohistochemical staining of human prostate shows moderate membranous and cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and CSPG4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419670).
HPA002951-100ul
HPA002951-100ul
HPA002951-100ul