Anti-SPARC
Artikelnummer:
ATA-HPA002989
- Bilder (6)
| Artikelname: | Anti-SPARC |
| Artikelnummer: | ATA-HPA002989 |
| Hersteller Artikelnummer: | HPA002989 |
| Alternativnummer: | ATA-HPA002989-100,ATA-HPA002989-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ON |
| secreted protein, acidic, cysteine-rich (osteonectin) |
| Anti-SPARC |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6678 |
| UniProt: | P09486 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SPARC |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human placenta shows strong positivity in endothelial cells and fibroblasts. |
|
|
Western blot analysis in human cell lines U2OS and HeLa using Anti-SPARC antibody. Corresponding SPARC RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis using Anti-SPARC antibody HPA002989 (A) shows similar pattern to independent antibody HPA003020 (B). |
|
|
HPA002989-100ul |
|
|
HPA002989-100ul |
|
|
HPA002989-100ul |
Produktgarantie und fachkundiger Support
