Anti-SPARC
Catalog Number:
ATA-HPA002989
- Images (6)
| Article Name: | Anti-SPARC |
| Biozol Catalog Number: | ATA-HPA002989 |
| Supplier Catalog Number: | HPA002989 |
| Alternative Catalog Number: | ATA-HPA002989-100,ATA-HPA002989-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ON |
| secreted protein, acidic, cysteine-rich (osteonectin) |
| Anti-SPARC |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6678 |
| UniProt: | P09486 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SPARC |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human placenta shows strong positivity in endothelial cells and fibroblasts. |
|
|
Western blot analysis in human cell lines U2OS and HeLa using Anti-SPARC antibody. Corresponding SPARC RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis using Anti-SPARC antibody HPA002989 (A) shows similar pattern to independent antibody HPA003020 (B). |
|
|
HPA002989-100ul |
|
|
HPA002989-100ul |
|
|
HPA002989-100ul |
Product Guarantee and Expert Support
