Anti-CTSD Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA003001
Artikelname: Anti-CTSD Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA003001
Hersteller Artikelnummer: HPA003001
Alternativnummer: ATA-HPA003001-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLN10, CPSD
cathepsin D
Anti-CTSD
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 1509
UniProt: P07339
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CTSD
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemical staining of human small intestine shows moderate to strong granular cytoplasmic positivity in glandular and lymphoid cells.
Immunohistochemical staining of human skeletal muscle shows occasional granular cytoplasmic positivity in a subset of myocytes.
Western blot analysis in human cell line SK-BR-3.
HPA003001
HPA003001
HPA003001