Anti-CTSD Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA003001
Article Name: Anti-CTSD Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA003001
Supplier Catalog Number: HPA003001
Alternative Catalog Number: ATA-HPA003001-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CLN10, CPSD
cathepsin D
Anti-CTSD
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 1509
UniProt: P07339
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CTSD
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemical staining of human small intestine shows moderate to strong granular cytoplasmic positivity in glandular and lymphoid cells.
Immunohistochemical staining of human skeletal muscle shows occasional granular cytoplasmic positivity in a subset of myocytes.
Western blot analysis in human cell line SK-BR-3.
HPA003001
HPA003001
HPA003001