Anti-BNIP3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA003015
Artikelname: Anti-BNIP3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA003015
Hersteller Artikelnummer: HPA003015
Alternativnummer: ATA-HPA003015-100,ATA-HPA003015-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Nip3
BCL2/adenovirus E1B 19kDa interacting protein 3
Anti-BNIP3
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 664
UniProt: Q12983
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BNIP3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemical staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Western blot analysis in human cell line U-87 MG.
HPA003015
HPA003015
HPA003015