Anti-BNIP3 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-BNIP3 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA003015
• Supplier Catalog Number: HPA003015
• Alternative Catalog Number: ATA-HPA003015-100,ATA-HPA003015-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: Nip3

Product Description

BCL2/adenovirus E1B 19kDa interacting protein 3

Additional Information

Anti-BNIP3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 664
• UniProt: Q12983
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: BNIP3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.

Immunohistochemical staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Western blot analysis in human cell line U-87 MG.

HPA003015

HPA003015

HPA003015