Anti-MDP1

Artikelnummer: ATA-HPA003064
Artikelname: Anti-MDP1
Artikelnummer: ATA-HPA003064
Hersteller Artikelnummer: HPA003064
Alternativnummer: ATA-HPA003064-100,ATA-HPA003064-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FN6Pase, MGC5987
magnesium-dependent phosphatase 1
Anti-MDP1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 145553
UniProt: Q86V88
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MDP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Western blot analysis in human cell lines MCF-7 and HeLa using Anti-MDP1 antibody. Corresponding MDP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA003064-100ul
HPA003064-100ul
HPA003064-100ul