Anti-MDP1

Catalog Number: ATA-HPA003064
Article Name: Anti-MDP1
Biozol Catalog Number: ATA-HPA003064
Supplier Catalog Number: HPA003064
Alternative Catalog Number: ATA-HPA003064-100,ATA-HPA003064-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FN6Pase, MGC5987
magnesium-dependent phosphatase 1
Anti-MDP1
Clonality: Polyclonal
Isotype: IgG
NCBI: 145553
UniProt: Q86V88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MDP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Western blot analysis in human cell lines MCF-7 and HeLa using Anti-MDP1 antibody. Corresponding MDP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA003064-100ul
HPA003064-100ul
HPA003064-100ul