Anti-TMX1
Artikelnummer:
ATA-HPA003085
- Bilder (8)
| Artikelname: | Anti-TMX1 |
| Artikelnummer: | ATA-HPA003085 |
| Hersteller Artikelnummer: | HPA003085 |
| Alternativnummer: | ATA-HPA003085-100,ATA-HPA003085-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PDIA11, TMX, TXNDC, TXNDC1 |
| thioredoxin-related transmembrane protein 1 |
| Anti-TMX1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 81542 |
| UniProt: | Q9H3N1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TMX1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & endoplasmic reticulum. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Western blot analysis in human cell line CAPAN-2. |
|
|
|
|
|
|
|
|
HPA003085-100ul |
|
|
HPA003085-100ul |
|
|
HPA003085-100ul |
Produktgarantie und fachkundiger Support
