Anti-TMX1
Catalog Number:
ATA-HPA003085
- Images (8)
| Article Name: | Anti-TMX1 |
| Biozol Catalog Number: | ATA-HPA003085 |
| Supplier Catalog Number: | HPA003085 |
| Alternative Catalog Number: | ATA-HPA003085-100,ATA-HPA003085-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PDIA11, TMX, TXNDC, TXNDC1 |
| thioredoxin-related transmembrane protein 1 |
| Anti-TMX1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 81542 |
| UniProt: | Q9H3N1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TMX1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & endoplasmic reticulum. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Western blot analysis in human cell line CAPAN-2. |
|
|
|
|
|
|
|
|
HPA003085-100ul |
|
|
HPA003085-100ul |
|
|
HPA003085-100ul |
Product Guarantee and Expert Support
