Anti-ZNF177 ChIP certified

Artikelnummer: ATA-HPA003141
Artikelname: Anti-ZNF177 ChIP certified
Artikelnummer: ATA-HPA003141
Hersteller Artikelnummer: HPA003141
Alternativnummer: ATA-HPA003141-100,ATA-HPA003141-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ZNF177
zinc finger protein 177
Anti-ZNF177
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 7730
UniProt: Q13360
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNLASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGINTNCVRTHSGEMP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ZNF177
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human testis shows weak to moderate nuclear and cytoplasmic positivity in a subset of cells in seminiferous ducts.
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
HPA003141-100ul
HPA003141-100ul
HPA003141-100ul